SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5X6F7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5X6F7
Domain Number 1 Region: 255-292,360-479
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000000183
Family Pseudo ankyrin repeat 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K5X6F7
Sequence length 1214
Comment (tr|A0A2K5X6F7|A0A2K5X6F7_MACFA) Transient receptor potential cation channel subfamily M member 4 {ECO:0000313|Ensembl:ENSMFAP00000045080} OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=TRPM4 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MVVSEKEQSWIPKIFKKKTCTTFIVDSTDPGGTLCQCGRPRTAHPAVAMEDAFGAAVVTV
WDSDAHTTEKPTDAYGELDFMGAGRKHSNFLRLSDRTDPATVYSLVTRTWGFRAPNLVVS
VLGGSGGPVLQTWLQDLLRRGLVRAAQSTGAWIVTGGLHTGIGRHVGVAVRDHQTASTGG
TKVVAMGVAPWGVVRNRDTLTNPKGSFPARYRWHGDPEDGVQFPLDYNYSAFFLVDDGTH
CRLGGESRFRLRLESYISQQKTGVGGTGIDIPVLLLLIDGDEKMLTQIENATQAQLPCLL
VAGSGGAADCLAETLEDTLAPGSGGARQGEARDRIRRFFPKGDPEVLQAQVERIMTRKEL
LTVYSSEDGSEEFETIVLKALVKACGSSEASAYLDELRLAVAWNRVDIAQSELFRGDIQW
RSFHLEASLMDALLNDRPEFVRLLISHGLSLGRFLTPMRLAQLYGAAPPHSLIRNLLDQA
SHSAGTKALAQKGGAAEPRPPDVGHVLRMLLGKMCAPRYPSGGAWDPHPGQGFGESMCLL
SDKATSLLSLDADLGQAPWSDLLIWALLLNRAQMAMYFWEMGSNAVSSALGACLLLRVMA
RLEPDAEEAARRKDLAIKFEGMGVDLFGECYHSSEVRAARLLLRRCPLWGDATCLQLAMQ
ADARAFFAQDGVQSLLTQKWWGDMASTTHIWALVLAFFCPPLIYTRLITFRKSEEEHTRE
ELEFDMDSAVNGEGPVGTADPAEKTPLGVPRQPGRRDCCGGYCGGHWCLRRWFHFWGAPV
TVFMGNVVSYLLFLLLFARVLLVDFQPAPPGALELLLYFWAFTLLCEELRQGLSGGGGSL
ASGGPGPGHASLSQRLCLYLADSWNQCDLVALTCFLLGVGCRLTPGLYHLGRTVLCIDFM
VFTVRLLHIFTVNKQLGPKIVIVNKMMKDVFFFLFFLGVWLVAYGVATEGLLRPRNSDLP
SILRRVFYRPYLQIFGQIPQEDMDVALMEHSNCSSEPGFWAHPPRTQAGVCVSQYANWLV
VLLLVIFLLVANILLVNLLIAMFSYTFGKVQGNSDLYWKAQRYRLIREFHSRPTLAPPFI
VISHLRLLLRQLCRRPRSPQPFSPTLEHFLVCLSKEAERKLLTWESVHKENFLLARARDK
RESDSERLKRTSQKVDMALKQLGHIREYEQRLKVLEREIQHCSRVLGWVAEALSRSALLP
PGGPPPPDLPGPKD
Download sequence
Identical sequences A0A2K5X6F7
XP_005589926.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]