SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5Y8X3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5Y8X3
Domain Number 1 Region: 136-302
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 9.94e-28
Family Toll/Interleukin receptor TIR domain 0.00073
Further Details:      
 
Domain Number 2 Region: 1-90
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000354
Family I set domains 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5Y8X3
Sequence length 437
Comment (tr|A0A2K5Y8X3|A0A2K5Y8X3_MANLE) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLEP00000012016} KW=Complete proteome OX=9568 OS=Mandrillus leucophaeus (Drill) (Papio leucophaeus). GN= OC=Catarrhini; Cercopithecidae; Cercopithecinae; Mandrillus.
Sequence
GDSANLTCRAFFGYSGDVSPLIYWMKGEKFIEDLDENRVWESDIRILKEHLGEQEVSISL
IVDSVEEGDLGNYSCYVENGNGRRHASVLLHKRELMYTVELAGGLGAILLLLVCLVTIYK
CYKIEIMLFYRNHFGAEELDGDNKDYDAYLSYTKVDPDQWNQETGEEERFALEILPDMLE
KHYGYKLFIPDRDLIPTGTYIEDVARCVDQSKRLIIVMTPNYVVRRGWSIFELETRLRNM
LVTGEIKVILIECSELRGIMNYQEVEALKHTIKLLTVIKWHGPKCNKLNSKFWKRLQYEM
PFKRIEPITHEQALDVSEQGPFGELQTVSAISMAAATSTALATAHPDLRSTFHNTYHSQM
RQKHYYRSYEYDVPPTGTLPLTSIGNQHTYCNIPMTLINGQRPQTKSSREQNPDEAHTNS
AILPLLPRETSISSVIW
Download sequence
Identical sequences A0A0A0MR17 A0A2J8L3D9 A0A2J8WJ76 A0A2K5Y8X3 A0A2K6CR44 D2H5T1 F1PYR3 F7IJ18 G3SU49 H0X9X2 W5Q9A4
ENSP00000305200 ENSCJAP00000014102 ENSNLEP00000012304 ENSOGAP00000012392 ENSCAFP00000020084 ENSCJAP00000014102 ENSCAFP00000020084 ENSOARP00000019296 ENSPTRP00000037316 ENSLAFP00000003644 ENSOGAP00000012392 ENSLAFP00000003644 ENSNLEP00000012304 ENSPTRP00000037316 9823.ENSSSCP00000012983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]