SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6ACA2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6ACA2
Domain Number 1 Region: 263-297
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000589
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K6ACA2
Sequence length 318
Comment (tr|A0A2K6ACA2|A0A2K6ACA2_MANLE) Ciliogenesis associated TTC17 interacting protein {ECO:0000313|Ensembl:ENSMLEP00000037699} KW=Complete proteome OX=9568 OS=Mandrillus leucophaeus (Drill) (Papio leucophaeus). GN=CATIP OC=Catarrhini; Cercopithecidae; Cercopithecinae; Mandrillus.
Sequence
MSSKVYSTGSRAKDHQPTGVECLPLPEANAEAIDFLSSLHEEELQMLFFSESLAMVSDTG
EPQGELTIEVQRGKYQEKLGVLTSCLFVHAFSRGFLDKMLCGNSLLGYLSEKLELMEQHS
QDFIKFLILPMERKTSLLKQDDQLAVTRSIKEGEQDLGFQTIQVDHQQAEVFIVEQTVHS
EEGIPMSCQYYLLSDGHLAKRIQVGSPGCCIITKMPILREVDEIEPRPVFEKKPPVWEED
MELYSKFLDRKEELRLGHASYLRQHPEAHALISDFLLFLLLRQPEDVVTFAAEFFGPFDP
RRPSSPALGSSHRPNPFR
Download sequence
Identical sequences A0A2K6ACA2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]