SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6B238 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6B238
Domain Number 1 Region: 172-434
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1e-86
Family Eukaryotic proteases 0.00000000062
Further Details:      
 
Domain Number 2 Region: 69-175
Classification Level Classification E-value
Superfamily Kringle-like 1.88e-31
Family Kringle modules 0.00000869
Further Details:      
 
Domain Number 3 Region: 36-84
Classification Level Classification E-value
Superfamily FnI-like domain 9.42e-21
Family Fibronectin type I module 0.0000923
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K6B238
Sequence length 436
Comment (tr|A0A2K6B238|A0A2K6B238_MACNE) Plasminogen activator, tissue type {ECO:0000313|Ensembl:ENSMNEP00000005453} KW=Complete proteome OX=9545 OS=Macaca nemestrina (Pig-tailed macaque). GN=PLAT OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MNAMKRGLCCVLLLCGAVFALPSQEIHARFRRGARSYQVICRDEKTQMIYQQHQSWLRPM
LRSNRVEYCWCNSGRAQCHSVPVKRNSDCYLGNGLAYRGTHSLTASGASCLPWNSMMLIG
KVYTAQNPNAQALGLGKHNYCRNPDGDAKPWCHVLKNRRLTWEYCDVPSCSTCGLRQYSQ
PQFRIKGGLFADIASHPWQAAIFAKHRRLPGERFLCGGILISSCWILSAAHCFQERFPPH
HLTVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSHCAQESSVV
RTVCLPPADLQLPDWTECELSGYGKHEALSPFYSERLKEAHVRLYPSSRCTSQHLLNRTV
TDNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNGGRMTLVGIISWGLGCGQKDVPGVY
TKVTNYLDWIQDNMQP
Download sequence
Identical sequences A0A2K6B238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]