SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6B9L3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6B9L3
Domain Number 1 Region: 26-165
Classification Level Classification E-value
Superfamily PRC-barrel domain 3.06e-63
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.000000174
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K6B9L3
Sequence length 171
Comment (tr|A0A2K6B9L3|A0A2K6B9L3_MACNE) Calmodulin regulated spectrin associated protein family member 3 {ECO:0000313|Ensembl:ENSMNEP00000008103} KW=Complete proteome OX=9545 OS=Macaca nemestrina (Pig-tailed macaque). GN=CAMSAP3 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MSPSRLPGSRERDWENGSNASSPASVPEYTGPRLYKEPSAKSNKFIIHNALSHCCLAGKV
NEPQKNRILEEIEKSKANHFLILFRDSSCQFRALYTLSGETEELSRLAGYGPRTVTPAMV
EGIYKYNSDRKRFTQIPAKTMSMSVDAFTIQGHLWQGKKPTTPKKGGSTPK
Download sequence
Identical sequences A0A2K5YN04 A0A2K6B9L3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]