SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6CR71 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6CR71
Domain Number 1 Region: 211-363
Classification Level Classification E-value
Superfamily C-terminal domain of adenylylcyclase associated protein 1.7e-64
Family C-terminal domain of adenylylcyclase associated protein 0.000000339
Further Details:      
 
Domain Number 2 Region: 45-105
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 0.0000000000209
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.0052
Further Details:      
 
Domain Number 3 Region: 123-133
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000523
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K6CR71
Sequence length 365
Comment (tr|A0A2K6CR71|A0A2K6CR71_MACNE) Cyclase associated actin cytoskeleton regulatory protein 2 {ECO:0000313|Ensembl:ENSMNEP00000026154} KW=Complete proteome OX=9545 OS=Macaca nemestrina (Pig-tailed macaque). GN=CAP2 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MANMQGLVERLERAVSRLESLSAESHRPPGDCGEVNGVSGGVAPSVEAFDKLMNSMVAEF
LKNSRILAGDVETHAEMVHSAFQAQRSFLLMASQYQQPHEGPVASTVSAFSVLSSGPGLP
PPPPPPPPPGPPPLFENEGKKEESSPSRSALFAQLNQGEAITKGLRHVTDDQKTYKNPSL
RAQGGQTRSPTKSHTPSPTSPKSHPSQKHAPVLELEGKKWRVEYQEDRNDLVISETELKQ
VAYIFKCEKSTLQIKGKVNSIIIDNCKKLGLVFDNVVGIVEVINSQDIQIQVMGRVPTIS
INKTEGCHIYLSEDALDCEIVSAKSSEMNILIPQDGDYREFPVPEQFKTAWDGSKLITEP
AEIMA
Download sequence
Identical sequences A0A1D5RHX1 A0A2K5VWY1 A0A2K6CR71

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]