SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6EE32 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6EE32
Domain Number 1 Region: 11-169
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.2e-55
Family Capz alpha-1 subunit 0.000000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K6EE32
Sequence length 174
Comment (tr|A0A2K6EE32|A0A2K6EE32_PAPAN) F-actin-capping protein subunit alpha-2 {ECO:0000313|Ensembl:ENSPANP00000006369} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN= OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MIVVRYQIDNKKMVRIAAKFIIHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNLD
QFTPVKIEGYEDQVLITEHGDLGNGKFLDPKNRICFKFDHLRKEATDPRPCEVENAVESW
RTSVETALRAYVKEHYPNGVCTVYGKKIDGQQTIIACIESHQFQAKNFCCCFYF
Download sequence
Identical sequences A0A2K5IJ37 A0A2K5ZDF3 A0A2K6EE32 A0A2K6MZF3 A0A2K6NB26

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]