SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6FAV4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6FAV4
Domain Number 1 Region: 429-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.51e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 2 Region: 485-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.06e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 3 Region: 177-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.39e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 4 Region: 541-598
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.09e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 5 Region: 373-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.63e-22
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 6 Region: 317-374
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.93e-22
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 7 Region: 233-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-21
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 8 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.36e-21
Family KRAB domain (Kruppel-associated box) 0.00043
Further Details:      
 
Domain Number 9 Region: 139-191
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.79e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 583-635
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.73e-18
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 11 Region: 83-137
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000178
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 12 Region: 278-309
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000127
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K6FAV4
Sequence length 642
Comment (tr|A0A2K6FAV4|A0A2K6FAV4_PROCO) Uncharacterized protein {ECO:0000313|Ensembl:ENSPCOP00000011109} KW=Complete proteome OX=379532 OS=coquereli). GN= OC=Lemuriformes; Indriidae; Propithecus.
Sequence
MDLVAFEDVAVNFTQEEWALLDHSQKKLYRDVMQETFINLASIGKKWEDQNIEDQYKNQG
RNLRSHTAERLCERKEGSQFEETFSQTLNLKLKKKTLTGVKPYECSVCGKVYMCHSSLKR
HMRSHTEHRPYGYHKYGEKSYECKECGKRFNFRSSFRIHERTHTGEKPYKCKQCGKAFSW
PSSFQIHERTHTGEKPYECKECGKAFIYHTTFRGHMRMHTGEKPYKCKECGKTFSHPSSF
RNHERTHSGEKPYECKQCGKAFRYYQTFQIHERTHTGEKPYQCKQCGKALSCPTSFRSHE
RIHTGEKPYKCKKCGKAFSFPSSFRKHERIHTGEKPYDCKECGKAFISLPSFRRHMIMHT
GNGPYKCKECGKAFDCPSSFQIHERTHTGEKPYQCKQCGKAFSCSSSFRMHERTHTGEKP
HECKQCGKAFSCSSSVRIHERTHTGEKPYECKQCGKAFSCSSSFRMHERIHTGEKPYECK
QCGKAFSFSSSFRMHERTHTGEKPYECKQCGKAFSCSSSFRMHERTHTGEKPYECKQCGK
AFSCSSSIRIHERTHTGEKPYECKQCGKAFSCSSSVRMHERTHSGEKPYECKQCDKAFSC
SRSFRIHERTHTGEKPYECQQCGKAFKCSRSFRIHERTHTGE
Download sequence
Identical sequences A0A2K6FAV4
XP_012496820.1.63892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]