SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6FPK1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6FPK1
Domain Number 1 Region: 297-449
Classification Level Classification E-value
Superfamily C-terminal domain of adenylylcyclase associated protein 1.14e-64
Family C-terminal domain of adenylylcyclase associated protein 0.000000361
Further Details:      
 
Domain Number 2 Region: 45-215
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 5.36e-63
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.0000335
Further Details:      
 
Domain Number 3 Region: 209-245
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000837
Family Formin homology 2 domain (FH2 domain) 0.12
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K6FPK1
Sequence length 451
Comment (tr|A0A2K6FPK1|A0A2K6FPK1_PROCO) Cyclase associated actin cytoskeleton regulatory protein 2 {ECO:0000313|Ensembl:ENSPCOP00000015883} KW=Complete proteome OX=379532 OS=coquereli). GN=CAP2 OC=Lemuriformes; Indriidae; Propithecus.
Sequence
MADMQELVQRLERAVSRLEVLSAESRRPPGDCGEVNGVIRGVAPSVEAFDKLMNGMVAEF
LNNSRILAGDVETHNEVATLLKPISEKIQEIQTFRERNRGSNMFNHLSAVSESIPALGWI
AVSPKPGPYVKEMNDAATFYTNRVLKDYKHSDLRHVDWVKSYLSIWSELQAYIKEHHTTG
LTWSKTGPVASAVSAFSVLSSGPGFPPPPPPPPPPGPPPLFENEGRKEESSPSRSALFAQ
LNQGEAITKGLRHVTDDQKTYKNPSLRAQGGQTRSPTKSQTPSPTSPKSHPSQKHAPVFE
LEGKKWRVEYQEDRNDLVISETELKQVAYIFKCDKSTLQIKGKVNSITIDNCKKFGLVFD
NVVGIVEVINSKDIQIQVMGRVPTISINKTEGCHIYLSEDALDCEIVSAKSSEMNILIPQ
DDDYREFPVPEQFKTAWDGSKLVTEPAEIMA
Download sequence
Identical sequences A0A2K6FPK1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]