SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6FUW1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6FUW1
Domain Number 1 Region: 301-331
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000191
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K6FUW1
Sequence length 336
Comment (tr|A0A2K6FUW1|A0A2K6FUW1_PROCO) Uncharacterized protein {ECO:0000313|Ensembl:ENSPCOP00000017749} KW=Complete proteome OX=379532 OS=coquereli). GN= OC=Lemuriformes; Indriidae; Propithecus.
Sequence
RRASRQTDRRMSSQVERRVSEQADRRMSSQAERRASEQTDRRMSSQAERTSEQIDDKLPM
PSDQGASEQTDRRMSGQVERRTPEQTDQRSSGLANQGTSEQVDLRLSGLVDHKPSVKTHH
PVYGQGPKLPERQADQLPGNEAGSSEADQVHLVEKQDDYKEDHLSYYGTLGESEDSEMDK
GADYRVQPCKFEHSQIDLNSKLPHEVENETESVTITQAYNPVDAKSTSNFQAKGQGFFQR
LPSISSTLDYITGKEKTQATETNLDDFPEFEPGKRSYGYNQIYNRRFPSVVYEDPYEVSV
RYMEKHRILQIFQQITENLVYEKPEDPLNFMLCQVC
Download sequence
Identical sequences A0A2K6FUW1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]