SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6FVJ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6FVJ2
Domain Number 1 Region: 316-504
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.72e-37
Family Nucleotide and nucleoside kinases 0.000000992
Further Details:      
 
Domain Number 2 Region: 83-262
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.56e-28
Family Nucleotide and nucleoside kinases 0.0000467
Further Details:      
 
Domain Number 3 Region: 4-46
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000366
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K6FVJ2
Sequence length 506
Comment (tr|A0A2K6FVJ2|A0A2K6FVJ2_PROCO) Adenylate kinase 5 {ECO:0000313|Ensembl:ENSPCOP00000018000} KW=Complete proteome OX=379532 OS=coquereli). GN=AK5 OC=Lemuriformes; Indriidae; Propithecus.
Sequence
MNTNDAKEYLARREIPQLFESLLNGLMCSKPEDPVEYLESCLQKVKELGGCDKVKWDTFV
SQEKKTLPPLNGGQPRRSFLRNGGPGSGKGTQSLKIAERYGFQYISVGELLRKKIHSTSS
NRKWSLIAKIITNGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQICT
PDLVVFLACANQRLKERLLKRAEQQGRPDDNLKATQRRLMNFKQNAAPLVKYFQEKGLIM
TFDADRDEDEVFYDISVAVDNKLFPNKEATAGSGDLDPSMMLDTGEIIDTGSDYEDQGDD
QLNVFGEDTMGGFVEDLRRCKIIFMIGGPGSGKGTQCEKLVEKYGFTHLSTGELLRNELA
SESERSKLIRDIMERGDLVPSGIVLELLKEAMVARLSSTKGFLIDGYPREVRQGEEFGRK
IGHPHLVICMDCSADTMTNRLLQRSQGSPHTDDTTKTIAKRLEAYYRASIPVITYYETKT
QLQKINAEGTPEEVFLQLCTAIDSIF
Download sequence
Identical sequences A0A2K6FVJ2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]