SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6GDN4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6GDN4
Domain Number 1 Region: 8-50
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000000706
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K6GDN4
Sequence length 156
Comment (tr|A0A2K6GDN4|A0A2K6GDN4_PROCO) Sperm autoantigenic protein 17 {ECO:0000313|Ensembl:ENSPCOP00000024341} KW=Complete proteome OX=379532 OS=coquereli). GN=SPA17 OC=Lemuriformes; Indriidae; Propithecus.
Sequence
MSIPFSNTHYRIPQGFGNLLEGLTREILREQPENIPAFAAAYFENLLEKREKTNFDPAEW
GSKVDDRFYNNHAFKTKGKNDPKSLFLLSMKDSFEEEKEKEEVAALKIQAAFRGHMAREE
VKKMKSKTSEDTGFTPRKREKIIKIHQPCCGCHFFP
Download sequence
Identical sequences A0A2K6GDN4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]