SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6JMB2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6JMB2
Domain Number 1 Region: 119-240
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.14e-32
Family cAMP-binding domain 0.000000496
Further Details:      
 
Domain Number 2 Region: 248-372
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.17e-32
Family cAMP-binding domain 0.000000495
Further Details:      
 
Domain Number 3 Region: 14-62
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 1.96e-18
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000775
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K6JMB2
Sequence length 381
Comment (tr|A0A2K6JMB2|A0A2K6JMB2_RHIBE) Protein kinase cAMP-dependent type I regulatory subunit alpha {ECO:0000313|Ensembl:ENSRBIP00000000152} KW=Complete proteome OX=61621 OS=Rhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti). GN=PRKAR1A OC=Catarrhini; Cercopithecidae; Colobinae; Rhinopithecus.
Sequence
MESGSTAASEEARSLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFERLEKE
EAKQIQNLQKAGTRTDSREDEISPPPPNPVVKGRRRRGAISAEVYTEEDATSYVRKVIPK
DYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFSVSFIAGETVIQQGDEGDNFYVIDQG
ETDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTL
RKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGSA
AVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLG
PCSDILKRNIQQYNSFVSLSV
Download sequence
Identical sequences A0A096NU08 A0A2K5HE46 A0A2K5LJJ4 A0A2K5UUV7 A0A2K5XAN8 A0A2K6JMB2 A0A2K6QAI2 F6WM87
ENSMMUP00000002926 9544.ENSMMUP00000002926 ENSMMUP00000002926 ENSMMUP00000002929 ENSPANP00000016529 XP_005584844.1.63531 XP_005584845.1.63531 XP_005584846.1.63531 XP_010351415.1.97406 XP_010351416.1.97406 XP_011786969.1.43180 XP_011787695.1.43180 XP_011788416.1.43180 XP_011833876.1.47321 XP_011898139.1.92194 XP_011898140.1.92194 XP_014975676.1.72884 XP_014975677.1.72884 XP_014975678.1.72884 XP_014975680.1.72884 XP_017719021.1.44346 XP_017719032.1.44346 XP_017719041.1.44346 XP_017719049.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]