SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6JVN8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6JVN8
Domain Number 1 Region: 226-367
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.93e-35
Family cAMP-binding domain 0.00000177
Further Details:      
 
Domain Number 2 Region: 116-222
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.07e-26
Family cAMP-binding domain 0.00000465
Further Details:      
 
Domain Number 3 Region: 2-43
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000000144
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K6JVN8
Sequence length 376
Comment (tr|A0A2K6JVN8|A0A2K6JVN8_RHIBE) Protein kinase cAMP-dependent type II regulatory subunit alpha {ECO:0000313|Ensembl:ENSRBIP00000003073} KW=Complete proteome OX=61621 OS=Rhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti). GN=PRKAR2A OC=Catarrhini; Cercopithecidae; Colobinae; Rhinopithecus.
Sequence
MSHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVDYFTRLREARAPASVLPAATPRQSPG
HPTPEPGPDRVADAKGDSESEEDEDLEVPIPSRFNRRVSVCAETYNPDEEEEDTDPREQL
SQVLDAMFERIVKADEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQYDNRGSFGE
LALMYNTPRAATIVATSEGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLLKSLEVS
ERMKIVDVIGEKIYKDGERIITQGEKADSFYIIESGEVSILIRSKTKSNKDGGNQEVEIA
RCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQ
LVKMFGSSMDLGNLGQ
Download sequence
Identical sequences A0A2K6JVN8
XP_017723636.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]