SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6LIR8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6LIR8
Domain Number 1 Region: 264-406
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 7.59e-33
Family cAMP-binding domain 0.000000216
Further Details:      
 
Domain Number 2 Region: 138-260
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.44e-31
Family cAMP-binding domain 0.000000319
Further Details:      
 
Domain Number 3 Region: 2-43
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000000706
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K6LIR8
Sequence length 412
Comment (tr|A0A2K6LIR8|A0A2K6LIR8_RHIBE) Protein kinase cAMP-dependent type II regulatory subunit beta {ECO:0000313|Ensembl:ENSRBIP00000023421} KW=Complete proteome OX=61621 OS=Rhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti). GN=PRKAR2B OC=Catarrhini; Cercopithecidae; Colobinae; Rhinopithecus.
Sequence
MSIEIPAGLTELLQGFTVEVLRHQPADLLEFALQHFTRLQQENERKGTARFGHEGRTWGD
AGASAAAAGGGTPSKGVNFAEEPMHSDSEDGEEEEAAPADAGAFNAPVINRFTRRASVCA
EAYNPDEEEDDAESRIIHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKD
GEHVIDQGDDGDNFYVIDRGTYDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATIT
ATSPGALWGLDRVTFRRIIVKTIFIESLPFLKSLEFSERLKVVDVIGTKVYNDGEQIIAQ
GDSADSFFIVESGEVKITMKRKGKSEVEENGAVEIARCSRGQYFGELALVTNKPRAASAH
AIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGTNMDIVEPTA
Download sequence
Identical sequences A0A2K6LIR8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]