SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6LWV8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6LWV8
Domain Number 1 Region: 255-292,360-478
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000000119
Family Pseudo ankyrin repeat 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K6LWV8
Sequence length 907
Comment (tr|A0A2K6LWV8|A0A2K6LWV8_RHIBE) Transient receptor potential cation channel subfamily M member 4 {ECO:0000313|Ensembl:ENSRBIP00000028010} KW=Complete proteome OX=61621 OS=Rhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti). GN=TRPM4 OC=Catarrhini; Cercopithecidae; Colobinae; Rhinopithecus.
Sequence
MVVSEKEQSWIPKIFKKKTCTTFIVDSTDPGGTLCQCGRPRTAHPAVAMEDAFGAAVVTV
WDSDAHTTEKPTDAYGELDFTGAGRKHSNFLRLSDRTDPATVYSLVTRTWGFRAPNLVVS
VLGGSGGPVLQTWLQDLLRRGLVRAAQSTGAWIVTGGLHTGIGRHVGVAVRDHQTASTGG
TKVVAMGVAPWGVVRNRDTLTNPKGSFPARYRWHGDPEDGVQFPLDYNYSAFFLVDDGTH
CRLGGESRFRLRLESYISQQKTGVGGTGIDIPVLLLLIDGDEKMLTQIENATQAQLPCLL
VAGSGGAADCLAETLEDTLAPGSGGARQGEARDRIRRFFPKGDPEVLQAQVERIMTRKEL
LTVYSSEDGSEEFETIVLKALVKACGSSEASAYLDELRLAVAWNRVDIAQSELFRGDIQW
RSFHLEASLMDALLNDRPEFVRLLISHGLSLGRFLTPMRLAQLYGAAPPNSLIRNLLDQA
SHSAGTKALAQKAGAAEPGPPDVGHVLRMLLGKMCAPRYPSGGAWDPHPGQGFGESMGLL
SDKATSLLSLDADLGQAPWSDLLIWALLLNRAQMAMYFWEMGSNAVSSALGACLLLRVMA
RLEPDAEEAARRKDLAIKFEGMGVDLFGECYHSSEVRAARLLLRRCPLWGDATCLQLAMQ
ADARAFFAQDGVQSLLTQKWWGDMASTTPIWALILAFFCPPLIYTRLITFRKSEEEHTRE
ELEFDMDSAVNGEGPVGYTFGKVQGNSDLYWKAQRYRLIREFHSRPALAPPFIIISHLRL
LLRQLCRRPRSPQPSSPTLEHFRVCLSKEAERKLLTWESVQKENFLLARARDKRESDSER
LKRTSQKVDMALKQLGHIREYEQRLKVLEREIQHCSRVLGWVAESLSRSALLPPGGPPPP
DLPGPKD
Download sequence
Identical sequences A0A2K6LWV8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]