SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6M625 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6M625
Domain Number 1 Region: 6-47
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000418
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K6M625
Sequence length 487
Comment (tr|A0A2K6M625|A0A2K6M625_RHIBE) Calcium binding tyrosine phosphorylation regulated {ECO:0000313|Ensembl:ENSRBIP00000031220} KW=Complete proteome OX=61621 OS=Rhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti). GN=CABYR OC=Catarrhini; Cercopithecidae; Colobinae; Rhinopithecus.
Sequence
MISSKPRLVVPYGLKTLLEGISRAVLKINPSDINQFAAAYFQELTMYRGNTTVDIKDLVK
QFHQIKVEKWSEGTTPQKKLECVKEPEKTSVESKVPTQMEKSTDTDEDNVTRTEYSDKTT
QFPSVCAEPGAEQTEAVGDSSSKPATPKATTPPSSPPPTAVSPEFAYVPADPAQLAAQML
GKVSSIHSDQSDVLMVDVATSMPVVIKEVPSSEVAEDVMVAAPLVCSGKVLEVQVVSQTS
VHVDLGSQPKENEAEQSTASSVPLQDEQEPPAYDQAPEVTLQADIEVMSTVHISSVYNDV
PVIEGVVYIEQLPEQIVTPFTDQVACLKENEQSPPVSPKSVVEKTTSGISKKSVESVELA
QLEENAKYSSVYMEAEAASLLSDTSLKGQPEVSAQLLDAEGAIKIGSEKSLHLEVGITSI
VSDNTGQEESGENSVPQEMEGKPVLSGEAAEAVHSGTSVKSSSGPFPPAPEGLTAPEIEP
EGEATAE
Download sequence
Identical sequences A0A2K6M625
XP_017739493.1.44346 XP_017739495.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]