SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6N2V4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6N2V4
Domain Number 1 Region: 94-133
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000314
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K6N2V4
Sequence length 538
Comment (tr|A0A2K6N2V4|A0A2K6N2V4_RHIBE) Uncharacterized protein {ECO:0000313|Ensembl:ENSRBIP00000042376} KW=Complete proteome OX=61621 OS=Rhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti). GN= OC=Catarrhini; Cercopithecidae; Colobinae; Rhinopithecus.
Sequence
MSSPLAWELSELAALRPGFRLSAPHARVAPRTATHGRGRGRASHAGQPRLRSSCFGPSPG
KRRVVPSGGAQPRVLPALSPRSHLFPMASHPQTRIQAYLEKNKIGPLFEELMTKLITETP
DQPIPFLIDHLQSKQGNRGQLQRTLSGSAALWAESETSESKGTRRDFRSYDKPWQLNAKK
PKKSKSDLAVSNISPPSSDSKSLPRSVEHPKWNWRTKPQSRDFDELNHILQESKKLGKAL
ENLSRSIAISDELDKETVAFNSSILRPRVIGEWIGREENDADPLAAEMLQPPIPRSKNDQ
WESEDSGSSPAGSLKMEPKNKGLKQQQQQHKKLLAAMLSQDSFESIHSPTPSVTEEDIDN
EDDAMELLEDLNDLRMEGVTTLVPSGSKFNQGRPTYPAEPQAKVTLNICSRCARLQGDNL
AERTEESLPMLHSPDEKIPDSFDSLPGTEEALMEEGEEFEKASKLTGTGEASSGAGHSLK
NYMEEDESLKQLQVVHQPWILPSDTESEGVEAEQEKRSADLLLCVPCSSCPTLVYSGL
Download sequence
Identical sequences A0A2K6N2V4
XP_017737021.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]