SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6Q3Y9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6Q3Y9
Domain Number 1 Region: 12-117
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 1.44e-44
Family Nucleoplasmin-like core domain 0.0000037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K6Q3Y9
Sequence length 214
Comment (tr|A0A2K6Q3Y9|A0A2K6Q3Y9_RHIRO) Uncharacterized protein {ECO:0000313|Ensembl:ENSRROP00000023500} KW=Complete proteome OX=61622 OS=roxellana). GN= OC=Catarrhini; Cercopithecidae; Colobinae; Rhinopithecus.
Sequence
MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIV
EAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVE
EDAESEDEEEEDVKLLSISGKRSAPGGGNTPTKNAQKSNQNGKDSKTIITPRSKGQDSFK
KQEKTPKTPKGPTSVEDIKAKMQASMWKPSSSIM
Download sequence
Identical sequences A0A2K6Q3Y9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]