SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6QCA5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6QCA5
Domain Number 1 Region: 25-101
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000118
Family DEATH effector domain, DED 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K6QCA5
Sequence length 318
Comment (tr|A0A2K6QCA5|A0A2K6QCA5_RHIRO) Death effector domain containing {ECO:0000313|Ensembl:ENSRROP00000026414} KW=Complete proteome OX=61622 OS=roxellana). GN=DEDD OC=Catarrhini; Cercopithecidae; Colobinae; Rhinopithecus.
Sequence
MAGLKRQASQVWPEEHGEQEHGLYSLHRMFDIVGTHLTHRDVRVLSFLFVDVIDDHERGL
IRNGRDFLLALERQGRCDESNFRQVLQLLRIITRHDLLPYVTLKRRRAVCPDLVDKYLEE
TSIRYVTPRALSDPEPRPPQPPKTVPPHYPVVCCPTSGPQMCSKRPARGRATLGSQRKRR
KSVTPDPKEKQTCDIRLRVRAEYCQHETALQGNVFSNKQDPLERQFERFNQANTILKSRD
LGSIICDIKFSELTYLDAFWRDYINGSLLEALKGVFITDSLKQAVGHEAIKLLVNVDEED
YELGRQKLLRNLMLQALP
Download sequence
Identical sequences A0A2K6KZN0 A0A2K6QCA5
XP_004390231.1.4749 XP_004390232.1.4749 XP_004390233.1.4749 XP_004688451.1.23501 XP_010365411.1.97406 XP_010365412.1.97406 XP_010365415.1.97406 XP_017716316.1.44346 XP_017716317.1.44346 XP_017716318.1.44346 XP_017716319.1.44346 XP_017716320.1.44346 XP_017716321.1.44346 XP_017716322.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]