SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6R9K0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6R9K0
Domain Number 1 Region: 120-250
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 9.95e-33
Family cAMP-binding domain 0.000000843
Further Details:      
 
Domain Number 2 Region: 254-373
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.84e-23
Family cAMP-binding domain 0.00000646
Further Details:      
 
Domain Number 3 Region: 2-43
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000000157
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K6R9K0
Sequence length 382
Comment (tr|A0A2K6R9K0|A0A2K6R9K0_RHIRO) Protein kinase cAMP-dependent type II regulatory subunit alpha {ECO:0000313|Ensembl:ENSRROP00000037691} KW=Complete proteome OX=61622 OS=roxellana). GN=PRKAR2A OC=Catarrhini; Cercopithecidae; Colobinae; Rhinopithecus.
Sequence
MSHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVDYFTRLREARAPASVLPAATPRQSPG
HPTPEPGPDRVADAKGDSESEEDEDLEVPIPSRFNRRVSVCAETYNPDEEEEDTDPRVIH
PKTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFERIVKADEHVIDQGDDGDNFYVIE
RGTYDILVTKDNQTRSVGQYDNRGSFGELALMYNTPRAATIVATSEGSLWGLDRVTFRRI
IVKNNAKKRKMFESFIESVPLLKSLEVSERMKIVDVIGEKIYKDGERIITQTKSNKDGGN
QEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAFERLLGPCMDIMKRNI
SHYEEQLVKMFGSSMDLGNLGQ
Download sequence
Identical sequences A0A2K6R9K0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]