SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6RSR9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2K6RSR9
Domain Number - Region: 21-84
Classification Level Classification E-value
Superfamily STAT 0.0745
Family STAT 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K6RSR9
Sequence length 211
Comment (tr|A0A2K6RSR9|A0A2K6RSR9_RHIRO) BCL2 associated athanogene 2 {ECO:0000313|Ensembl:ENSRROP00000044077} KW=Complete proteome OX=61622 OS=roxellana). GN=BAG2 OC=Catarrhini; Cercopithecidae; Colobinae; Rhinopithecus.
Sequence
MAQAKINAKANEGRFCRSSSMADRSSRLLESLDQLELRVEALREAATAVEQEKEILLEMI
HSIQNSQDMRQISDGEREELNLTANRLMGRTLTVEVSVETIRNPQQQESLKHATRIIDEV
VNKFLDDLGNAKSHLMSLYSACSSEVPHGPVDQKFQSIVIGCALEDQKKIKRRLETLLRN
IENSDKAIKLLEHSKGAGTKTLQQNAESKFN
Download sequence
Identical sequences A0A096N6S8 A0A0D9RLU6 A0A2K5NTF8 A0A2K6CIS9 A0A2K6L5H8 A0A2K6RSR9 F7DMF0 G7P2X1
9544.ENSMMUP00000023655 ENSMMUP00000023655 NP_001247632.1.72884 XP_008011826.1.81039 XP_010386232.1.97406 XP_011735823.1.29376 XP_011924094.1.92194 XP_015304297.1.63531 XP_017723693.1.44346 ENSPANP00000008205 ENSMMUP00000023655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]