SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6S601 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6S601
Domain Number 1 Region: 58-240
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.33e-43
Family Ankyrin repeat 0.00042
Further Details:      
 
Domain Number 2 Region: 251-306,391-428
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000785
Family Pseudo ankyrin repeat 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K6S601
Sequence length 481
Comment (tr|A0A2K6S601|A0A2K6S601_SAIBB) Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 {ECO:0000313|Ensembl:ENSSBOP00000002815} KW=Complete proteome OX=39432 OS=Saimiri boliviensis boliviensis (Bolivian squirrel monkey). GN=ASZ1 OC=Platyrrhini; Cebidae; Saimiriinae; Saimiri.
Sequence
MAASMATSALRGLAVAGGGESSESEDDGWEIGYLDRTSQKLKGQMLPIEEKKEKFKKALT
TGDVSLVQELLDSGIISVDATFRYGWTPLMYAASVANAELVRVLLDRGANASFEKDKQTI
LITACSAHGSEEQILKCVELLLSRNADPNVACRRLMTPIMYAARDGHTQVVALLVASGAE
VNTQDENGYTALTWAARQGHKSIVLKLLELGANKMLQTKDGKLPSEIAKRNKHHEIFNLL
SFTLNPLEGKLQQLTKEETICKILTTDSDRENDHIFSSYAEFGDLEVFLHGLGLEHMTDL
LKERDITLRQLLTMREDEFTKNGFASKDQQKILAALKELEVEEIQFGELSEEAKLEISGD
EFLNFLLKLNKQCGHLITAVQNIITELPVNSQKIALEWASPQNFTSVCEELVNNVEDLSE
EVCNLKDLIQKLQNERENDPTHIPLREEVSTWNSRILKRTAITVCGFGFLLFICKITFQR
K
Download sequence
Identical sequences A0A2K6S601
XP_003921102.1.74449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]