SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6V5U9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6V5U9
Domain Number 1 Region: 115-236
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.7e-33
Family cAMP-binding domain 0.00000043
Further Details:      
 
Domain Number 2 Region: 244-368
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.14e-32
Family cAMP-binding domain 0.000000495
Further Details:      
 
Domain Number 3 Region: 10-58
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 1.94e-18
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000775
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K6V5U9
Sequence length 377
Comment (tr|A0A2K6V5U9|A0A2K6V5U9_SAIBB) Protein kinase cAMP-dependent type I regulatory subunit alpha {ECO:0000313|Ensembl:ENSSBOP00000039544} KW=Complete proteome OX=39432 OS=Saimiri boliviensis boliviensis (Bolivian squirrel monkey). GN=PRKAR1A OC=Platyrrhini; Cebidae; Saimiriinae; Saimiri.
Sequence
MASNLCEARSLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFERLEKEEAKQ
IQNLQKAGTRTDSREDEISPPPPNPVVKGRRRRGAISAEVYTEEDAASYVRKVIPKDYKT
MAALAKAIEKNVLFSHLDDNERSDIFDAMFPVSFIAGETVIQQGDEGDNFYVIDQGEMDV
YVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRKRK
MYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGSAAVLQ
RRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLGPCSD
ILKRNIQQYNSFVSLSV
Download sequence
Identical sequences A0A2K5QVE7 A0A2K6V5U9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]