SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K7ZM30 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K7ZM30
Domain Number 1 Region: 35-192
Classification Level Classification E-value
Superfamily EspA/CesA-like 1.31e-58
Family EspA-like 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K7ZM30
Sequence length 195
Comment (tr|A0A2K7ZM30|A0A2K7ZM30_YEREN) Chemotaxis protein {ECO:0000313|EMBL:AHM76164.1} KW=Complete proteome OX=1443113 OS=Yersinia enterocolitica LC20. GN=LC20_04912 OC=Yersiniaceae; Yersinia.
Sequence
MSTNTYISMPEYSSAPAAKPFVGDVKKNIAPYAANNSDDIFSIGLEVLYSFLDVLSNIAS
TNFKSMQARSKYASDTQDMSNQVDEVIAKAAKGDDKTKERLPDSVINFMRENGITVDGMS
IDKYLSEHGPELDKGQLQAVKAALDNEKNRATDTMSQDQLQLQKIMQSYNVCANNISTLQ
TGLKDLLMTIARSFC
Download sequence
Identical sequences A0A208ZWD9 A0A2K7ZM30
WP_025379803.1.19252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]