SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0BCV6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0BCV6
Domain Number - Region: 35-69
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00235
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0BCV6
Sequence length 83
Comment (tr|A0BCV6|A0BCV6_PARTE) Uncharacterized protein {ECO:0000313|EMBL:CAK56373.1} KW=Complete proteome; Reference proteome OX=5888 OS=Paramecium tetraurelia. GN=GSPATT00004467001 OC=Oligohymenophorea; Peniculida; Parameciidae; Paramecium.
Sequence
MSQEHDLDDIAEQQLAEQTALSQIPSIPDQALPTRQYLEKAVIDQLHDALKALARERPKN
PIEFFSYYLLTQHCNKKKELQEQ
Download sequence
Identical sequences A0BCV6
XP_001423771.1.48737 GSPATP00004467001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]