SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0BEN9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0BEN9
Domain Number - Region: 13-52
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0915
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0BEN9
Sequence length 622
Comment (tr|A0BEN9|A0BEN9_PARTE) Uncharacterized protein {ECO:0000313|EMBL:CAK57006.1} KW=Complete proteome; Reference proteome OX=5888 OS=Paramecium tetraurelia. GN=GSPATT00028039001 OC=Oligohymenophorea; Peniculida; Parameciidae; Paramecium.
Sequence
MNLIPETDKIDMAYLKSERIGKVITKGLAELYQVKPQFPIEYLAKWLLNHNRTEANRGSM
QDHVSHKEALIEQQKKEQEVQEEKDRREQQLQDEENLRELEFQNIIKTHEFHYKLLVKDF
CNHLQKKGLTGVYVGYVDFPSKQINENDDDENAHLDTEQPKLIKYIGANDDHNFMISQTL
PLNEVGITGEVFREIPPPEEGQQPQSPIIYIPDVTKEQRLVYFKWKKLGAFLAIPLVYQS
CLFPASLDAGIEERLRFKKADAEKKLDKENKINEFNARLKEATETEQDPTPIQEELDQYL
ANWQDESEAPYQSQKRQFVVCFDTLGKDVEISQKDRQYFEDYVNLFALSWNQMECKLLSD
DIDHMIAYQEQGVKERSEALTVQEEQAVESQQSQYDDLKDREKEYQFALLSIRVSTVAQQ
IQQLQQELFSLKQVRVLKYPGLLLSLMLFLNYNKENLLEKGTNQLDWTGVKHYICEDMIQ
KILDYEYRGAKTEEVPKYAKLNRIKKRISKYTVEQVEEYNVCYAKILKWMQYIIKLRVED
IEIRREKIANLRKLIQETTEQVAKIKEEKELKFEEYKNSIQQQEDQEPPNREEWELKYDE
EHPLPKIPENVPDDVDNDFDEE
Download sequence
Identical sequences A0BEN9
XP_001424404.1.48737 GSPATP00028039001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]