SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0BF95 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0BF95
Domain Number 1 Region: 18-202
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000184
Family Tetratricopeptide repeat (TPR) 0.018
Further Details:      
 
Domain Number 2 Region: 404-514
Classification Level Classification E-value
Superfamily TPR-like 0.0000000125
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 
Weak hits

Sequence:  A0BF95
Domain Number - Region: 292-358
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0628
Family Pseudo ankyrin repeat 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0BF95
Sequence length 644
Comment (tr|A0BF95|A0BF95_PARTE) Uncharacterized protein {ECO:0000313|EMBL:CAK57212.1} KW=Complete proteome; Reference proteome OX=5888 OS=Paramecium tetraurelia. GN=GSPATT00028247001 OC=Oligohymenophorea; Peniculida; Parameciidae; Paramecium.
Sequence
MQPVQPIAEGQRTKIIYTLIKDQKYKEAINYLNYELQFCPKSRALSLLAYCHYMNQDFTS
AVGIYEQLVKYYPEIDDYKIYLAQSYYKDSLYDEALKVCASIENPQYQGKMVQLQALIRY
EKSEFQHAKTLLKQNNMDDPDSVINEGCILFKENKFDEARQRFQDGMNLTGYSCELAYNI
ALCYYKQKQLAQSLKYIAEIIERGVRERPDLGVGSNAEGIEVKSVGNSQALKESALIEAF
NLKAAIEYSIKNFDAAKEALVDMPPREEDELDPVTLMNQALMNIEEKTAEGFKKLNHLLQ
NPPFPPETFPNLLLLYCKYGYYDMAADILAENADLTFKTISSDDFEFVDALILSAASPEE
SFRKFQILANKHIDTLRRITKSIQDARLNRDNEGIKKSLKEFDDCLEKFIPVLMAQAKIY
WDKDNYSQVEKLFRQSAEFCADHDVWKLNVAHVFYVQDNKYREAIRYYEPIVKKNSDNLL
SLTAIVIANLCVSYIMVNQNEDAEEMMRKLEKEEEKSQYQDPEKSVYHLCIVNLVIGTLY
CSKNNYEFGISRVIKSLEPYNKKINTDTWYYAKRCFLALIEVLAKHMIILKDTSYSEILD
FLDAADQCGKSIPSVINPLEQLDEKHTISYEARMIKRMFLKLRT
Download sequence
Identical sequences A0BF95
GSPATP00028247001 XP_001424610.1.48737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]