SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0BLK4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0BLK4
Domain Number 1 Region: 237-362
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.02e-32
Family cAMP-binding domain 0.00021
Further Details:      
 
Domain Number 2 Region: 108-234
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.98e-30
Family cAMP-binding domain 0.00045
Further Details:      
 
Weak hits

Sequence:  A0BLK4
Domain Number - Region: 12-47
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000235
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0BLK4
Sequence length 374
Comment (tr|A0BLK4|A0BLK4_PARTE) Uncharacterized protein {ECO:0000313|EMBL:CAK59421.1} KW=Complete proteome; Reference proteome OX=5888 OS=Paramecium tetraurelia. GN=GSPATT00030054001 OC=Oligohymenophorea; Peniculida; Parameciidae; Paramecium.
Sequence
MNNKERIARYKEKVNDVLQKMVYELFKSQPENYIEWMIQYLEQLKNNSSMTQHLNTAVEY
NLSSDQDDNEEIEELPLPPKNSKAFRSSVSAEVFGIHNKKENFIPRVIPKTEEQKQQILE
KLMKVFMFQALGQHEQEIVVNAMEEKHFTKDDWVINQGEDGAELYIVFSGELDCFRRMKP
TDEEPKFLKQYKSGDMFGELSLLYNSPRAASIQAKVDSVLFALDRSTFNNIVKDATMKKR
QQYEEVLSKVELLQSMDAYEKTQICDGLKEHSYLEGQVIIQEGEEGDKFYMVAEGSLAAF
KDNNGQQEEVLRYQTGDYFGELALIHKMPRQATIKAETDCVVVYLDSNSFLRLLGPVEDI
LRRNADTYKKFLSN
Download sequence
Identical sequences A0BLK4
XP_001426819.1.48737 GSPATP00030054001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]