SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0C7M0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0C7M0
Domain Number 1 Region: 171-257
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000244
Family Myb/SANT domain 0.033
Further Details:      
 
Domain Number 2 Region: 122-192
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000507
Family Myb/SANT domain 0.0081
Further Details:      
 
Weak hits

Sequence:  A0C7M0
Domain Number - Region: 275-318
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 0.068
Family Delta-sleep-inducing peptide immunoreactive peptide 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0C7M0
Sequence length 342
Comment (tr|A0C7M0|A0C7M0_PARTE) Uncharacterized protein {ECO:0000313|EMBL:CAK66787.1} KW=Complete proteome; Reference proteome OX=5888 OS=Paramecium tetraurelia. GN=GSPATT00035917001 OC=Oligohymenophorea; Peniculida; Parameciidae; Paramecium.
Sequence
MSFLHIQSYQQSTEESSHPLNSKLNFVQIQAIDLKPYKKKWRLLFNNVPSPKILESIYYD
LQGQTIEDRETKEMIFLQCILLNMRAPLNLKLNEEQWIHISELMPTYKTPLKWSQICQQF
VHQSAYNNPWSENEDKLLLDIILSFQRMKKGNKWSKIARELNERSLNKFIRTPKQCRERW
GNKLDPSINRQDLNLIMFRNEWTDQEDLNFLQLLLQHGRRWAELSIRLSPITNNQKRTEF
SLKHRFKKLISSTNSAESRSINGTKYAISSDWNNKEINKLLGKISQLEMKTNQREVENFY
YHPLTKQIKLNDFNKLVIIRGSSKVELDLSILFNQTNSQLND
Download sequence
Identical sequences A0C7M0
XP_001434184.1.48737 GSPATP00035917001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]