SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0CIB6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0CIB6
Domain Number - Region: 7-36
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0628
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0CIB6
Sequence length 69
Comment (tr|A0CIB6|A0CIB6_PARTE) Uncharacterized protein {ECO:0000313|EMBL:CAK70533.1} KW=Complete proteome; Reference proteome OX=5888 OS=Paramecium tetraurelia. GN=GSPATT00007668001 OC=Oligohymenophorea; Peniculida; Parameciidae; Paramecium.
Sequence
MNQQEQEKFNQIISNGYKELITKRPNKPLEHFIYYLLTSLPEEIRNKDQITRDFFEQYQE
IDLKDVKEI
Download sequence
Identical sequences A0CIB6
GSPATP00007668001 XP_001437930.1.48737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]