SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0CQ87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0CQ87
Domain Number 1 Region: 248-450
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.45e-25
Family Nucleotide and nucleoside kinases 0.00075
Further Details:      
 
Domain Number 2 Region: 54-183
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000738
Family Nucleotide and nucleoside kinases 0.0025
Further Details:      
 
Domain Number 3 Region: 11-53
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000314
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0CQ87
Sequence length 453
Comment (tr|A0CQ87|A0CQ87_PARTE) Uncharacterized protein {ECO:0000313|EMBL:CAK72954.1} KW=Complete proteome; Reference proteome OX=5888 OS=Paramecium tetraurelia. GN=GSPATT00009302001 OC=Oligohymenophorea; Peniculida; Parameciidae; Paramecium.
Sequence
MDQANKLQYQQQVEKYLERNKVYSIFEDLLKSLIIKKPDDPIQFLINKLQEPETKKIFVI
GPPGSKLLELSLTLAEYMNFHCVSIGDLIEKELSKKSELSQQIQDSLDKFQYVSDDIVIN
IALNQIQHFENEKKSYIFEGFPKTRVQGLAFQKEGIIPDAFLILEMSEEKIYQCCLKKLD
TEPFSKLSNKEELARNHSLEYQLNLKQVKEIYKNQYFSVDGEKNYELEDMAQRLKYKLYN
NAPTRAGRILVIGPPGSGRSTLAKHLCSRYGFVYISTRELISNLVNKKGTTGKEAFEKVN
KGELVDDRIINALIKERINQTDCQLQGYVLDGYPKTEQQMESLNELNIQPTLIVIIDAVD
DVVLKRLTQRRTDPISGRIYKSSDEADKEVKPRLVIAPNDKREIVQLRLKRWDDLNKLID
GTPKYASVIFKVSGDAQLNNMIESVCYHLEKMN
Download sequence
Identical sequences A0CQ87
GSPATP00009302001 XP_001440351.1.48737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]