SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0D0N2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0D0N2
Domain Number - Region: 68-125
Classification Level Classification E-value
Superfamily SEA domain 0.0405
Family SEA domain 0.03
Further Details:      
 
Domain Number - Region: 138-204
Classification Level Classification E-value
Superfamily PH domain-like 0.0414
Family Pleckstrin-homology domain (PH domain) 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0D0N2
Sequence length 230
Comment (tr|A0D0N2|A0D0N2_PARTE) Uncharacterized protein {ECO:0000313|EMBL:CAK76599.1} KW=Complete proteome; Reference proteome OX=5888 OS=Paramecium tetraurelia. GN=GSPATT00012151001 OC=Oligohymenophorea; Peniculida; Parameciidae; Paramecium.
Sequence
MQPKKMSSFLDSIKQFFNDAPSDEIIYNEATSSLPTESKLSKQSSQQSTKGRSSDPNVFK
IDNEDEANQIYNDEDEDLESQTMSEMQKEYRILILYNFKQVGKPLDSGYQKKQIINFPPG
STFRVIKPIKTHKSLMDYLSSETERYLALDGGWIYFFQLISKDKYLVSSANSLNNLTQIL
IKKNEAKPTFRFIFTTKQIKRFYLVNIEQQDLLFLKLKTECQKHGRSFNY
Download sequence
Identical sequences A0D0N2
XP_001443996.1.48737 GSPATP00012151001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]