SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0D2T3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0D2T3
Domain Number - Region: 205-273
Classification Level Classification E-value
Superfamily Tropomyosin 0.0016
Family Tropomyosin 0.013
Further Details:      
 
Domain Number - Region: 105-133
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 0.0863
Family Delta-sleep-inducing peptide immunoreactive peptide 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0D2T3
Sequence length 317
Comment (tr|A0D2T3|A0D2T3_PARTE) Uncharacterized protein {ECO:0000313|EMBL:CAK77350.1} KW=Complete proteome; Reference proteome OX=5888 OS=Paramecium tetraurelia. GN=GSPATT00012858001 OC=Oligohymenophorea; Peniculida; Parameciidae; Paramecium.
Sequence
MINTTTKREESFLTTKVSDRVITVENEQRSTYNFVRRNYLTTTFATLAGRQSNGVYNVAF
NTPCCQPCPQPCPQPQAMPMPIYIPMPYPQQCEKECHCEEEEQYKEEVLILRQRVAELLN
RQPQVKVEKETVKVENTTRIADLSMEIERLKINLRNEQDRLRQKEGEYLELRSDNSSQSL
KDRLAILESQLYNSKLDLEKLQGLLQAKLQELDEWEQRYHHMESTVTVESTETVTLTNEV
EVWKSRFKKLNNDFFETQEKLIMAQAELEALKKGGVTEVKSVTVQQNVTSSSVNRVIEQS
SRGSRIVDPNLVGKLYP
Download sequence
Identical sequences A0D2T3
XP_001444747.1.48737 GSPATP00012858001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]