SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0D2Y1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0D2Y1
Domain Number - Region: 12-58
Classification Level Classification E-value
Superfamily RecG, N-terminal domain 0.00536
Family RecG, N-terminal domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0D2Y1
Sequence length 114
Comment (tr|A0D2Y1|A0D2Y1_PARTE) Uncharacterized protein {ECO:0000313|EMBL:CAK77398.1} KW=Complete proteome; Reference proteome OX=5888 OS=Paramecium tetraurelia. GN=GSPATT00012883001 OC=Oligohymenophorea; Peniculida; Parameciidae; Paramecium.
Sequence
MSNLRYILMAIQDFELLCKLHHFDKYIKKSKSLIQQLGTLRIQQSEKLISLKRCNFIIFL
NNQEIVLDETILLQPLASESTIQRKSFLFFQIIEQQLLLIVQVGTFLSFIIAYY
Download sequence
Identical sequences A0D2Y1
GSPATP00012883001 XP_001444795.1.48737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]