SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0DY51 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0DY51
Domain Number - Region: 26-63
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00366
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0DY51
Sequence length 73
Comment (tr|A0DY51|A0DY51_PARTE) Uncharacterized protein {ECO:0000313|EMBL:CAK87968.1} KW=Complete proteome; Reference proteome OX=5888 OS=Paramecium tetraurelia. GN=GSPATT00002936001 OC=Oligohymenophorea; Peniculida; Parameciidae; Paramecium.
Sequence
MSSEDEVIKILYLPQRMKQLQQLPIRNYLDQTVVPILLQAMTEVAKVRPPNPIEFIASYL
TQNNPEKPQARQQ
Download sequence
Identical sequences A0DY51
GSPATP00002936001 XP_001455365.1.48737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]