SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0E9C2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0E9C2
Domain Number 1 Region: 3-58
Classification Level Classification E-value
Superfamily Nop10-like SnoRNP 1.44e-20
Family Nucleolar RNA-binding protein Nop10-like 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0E9C2
Sequence length 64
Comment (tr|A0E9C2|A0E9C2_PARTE) Uncharacterized protein {ECO:0000313|EMBL:CAK91889.1} KW=Complete proteome; Reference proteome OX=5888 OS=Paramecium tetraurelia. GN=GSPATT00024620001 OC=Oligohymenophorea; Peniculida; Parameciidae; Paramecium.
Sequence
MHLRYYLNEEGKRVYTLKNTLEDGSYTFNAHPARFSPDDVNQKYRVELKKRFGLLPTQGE
PHQF
Download sequence
Identical sequences A0E9C2
XP_001459286.1.48737 GSPATP00024620001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]