SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0Q3G8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0Q3G8
Domain Number - Region: 99-179,217-223
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0288
Family Pseudo ankyrin repeat 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0Q3G8
Sequence length 265
Comment (tr|A0Q3G8|A0Q3G8_CLONN) ISBma2, transposase {ECO:0000313|EMBL:ABK62605.1} KW=Complete proteome; Reference proteome OX=386415 OS=Clostridium novyi (strain NT). GN=NT01CX_0704 OC=Clostridium.
Sequence
MVRDGKPKGFFYLDHRTVDGKYNIITDVHVTPGNINDVDPYVKRIETQIEKFNFNTKYLV
ADAGYYTNPICKQISDKNYQGVFGFRLGPHVKGKYTKYRFQYVKELDGYVCINNCFLKYR
TTTREGYKEYLSNAEHCAYCKYKNNCLTSDKSINRTIRRHVWEDYKDQIFRFTKTEKGKS
IYKRRKEKIERSFADSKELHGLRYCRMRGIKNVSEQCLLTAVVQNMKKIAMVLSHYFLCT
LIQIYSKLTYIINIFRMLSHKRILA
Download sequence
Identical sequences A0Q3G8
386415.NT01CX_0704 gi|118445105|ref|YP_879170.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]