SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0YWP7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0YWP7
Domain Number 1 Region: 1-118
Classification Level Classification E-value
Superfamily XisI-like 8.11e-41
Family XisI-like 0.0000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0YWP7
Sequence length 132
Comment (tr|A0YWP7|A0YWP7_LYNSP) XisI protein-like protein {ECO:0000313|EMBL:EAW34607.1} KW=Complete proteome; Reference proteome OX=313612 OS=Lyngbya sp. (strain PCC 8106) (Lyngbya aestuarii (strain CCY9616)). GN=L8106_14320 OC=Oscillatoriaceae; Lyngbya.
Sequence
MDKLERYRQCICKFLAEQSVGENNEPDMECQLIFDGEHVRVASPLENHYQLLDIGWQGLK
RVYNCFIHLDIKDNKIWIQRNLTEVNIAQELVNRGIPPEDIVLGLHPPYKRPYTGYGVPS
ATVLSHSSQRSV
Download sequence
Identical sequences A0YWP7
WP_009786890.1.37782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]