SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0ZJN5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0ZJN5
Domain Number - Region: 56-82
Classification Level Classification E-value
Superfamily Moesin tail domain 0.00379
Family Moesin tail domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0ZJN5
Sequence length 105
Comment (tr|A0ZJN5|A0ZJN5_NODSP) Gas vesicle protein {ECO:0000313|EMBL:AHJ27876.1} KW=Complete proteome; Reference proteome OX=313624 OS=Nodularia spumigena CCY9414. GN=NSP_15420 OC=Bacteria; Cyanobacteria; Nostocales; Aphanizomenonaceae; Nodularia.
Sequence
MLDKGVVIAGDISISIASTELLHIRIRLLISSVDKAKEMGINWWENDPYLSSKAQRLIEE
NQQLQNRLESLESEINLLKSASILEETPLGEDIQHDVDTSNQEII
Download sequence
Identical sequences A0ZJN5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]