SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A1CQH5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A1CQH5
Domain Number - Region: 457-517
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00994
Family Pseudo ankyrin repeat 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A1CQH5
Sequence length 823
Comment (tr|A1CQH5|A1CQH5_ASPCL) Pentatricopeptide repeat protein {ECO:0000313|EMBL:EAW07896.1} KW=Complete proteome; Reference proteome OX=344612 OS=NCTC 3887 / NRRL 1). GN=ACLA_026130 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MSYCPQRLVRSRFSAGLPSWDPHHRWYRPRTGFQAARASSNDASNSRSLSSYPADTVVTH
PTLSPSLNDRRLTNVSWEGSSSVSDLKSSFHPVQTSRHDQIRSQSLKAPQDQSPHSEYEP
DASTPGSRRQAFGRFRGVLSIPERSNIFGSGSAPKIVYNTKVVINGHLRDRQRVLHPSAV
ALEKRIRYQSLFYSGAEVRKWRLACSDLYRSKFYEREMENELLITLKLDSVEQILLEKLK
IDSLGRFREAWESLSKREKSTRWHKLSLWVLKICPEYALDFLLVTNQSKDRPVFVMVADA
FLFLDAFHYDTLKRWRNGTHTYQSVLQSALRPSNWPILFLPQKGVRLFVKRASREAVHHA
FQLVRQRKIHTKAETYLCFMWRFTELGDIDKALEALGNVQRMRQADFQLDSDAVKRHCCK
LLTLDSVQEGPNGRNFYILPKLLEKGVRPDRDMMNIVLSNAFKTGDEQLGLDMLEYMRAN
GYEWDSYTYLTLLNDAVARGDRNRVTSLVREVEPDEELQKNPWIASKIFHAHFVFTGKHI
NPDDDPDAVFYSMLDMYNQLHDITPLKELSILPPEYTPPPGGDNTPPTPIALYLMIATYL
RCRKRVSIGQRLYSIFRSLVLQGHPAIAPLAATDHTYNEFLIAFRDNPRGLRPAMRVVED
MLQSSAQNETDLDPRGSPASHARPSARTWTILMSCFVYNNQPHAAEKVKEMMAEHNIDYN
KATWNVMVSNHANRQNVSDLAKTIKSMEDEGFIVDSYNMKSLRYLRDPERLWVALEELDK
MAEPPINKLASSKSSARVTEKKKSDQLLDRGLRRLSEKMKPKL
Download sequence
Identical sequences A1CQH5
XP_001269322.1.35617 ACLA_026130 5057.CADACLAP00001975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]