SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A1CW50 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A1CW50
Domain Number - Region: 4-38
Classification Level Classification E-value
Superfamily Aerolisin/ETX pore-forming domain 0.0602
Family (Pro)aerolysin, pore-forming lobe 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A1CW50
Sequence length 115
Comment (tr|A1CW50|A1CW50_NEOFI) Uncharacterized protein {ECO:0000313|EMBL:EAW24852.1} KW=Complete proteome; Reference proteome OX=331117 OS=A1164 / JCM 1740 / NRRL 181 / WB 181) (Aspergillus fischerianus). GN=NFIA_103400 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MASTSTPTSTSTSTSKSSTTVTASAPPTLHLSANFAGAHSKPHAGNPSAVGYDHEIYLQL
TAGEKAKEKTPNQVYREERARRRTTRALDLAILEPQGDPSPIDFECAEVQSKRDW
Download sequence
Identical sequences A1CW50
NFIA_103400||conserved XP_001266749.1.95823 36630.CADNFIAP00009818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]