SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A1HQJ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A1HQJ6
Domain Number - Region: 16-67
Classification Level Classification E-value
Superfamily Preprotein translocase SecE subunit 0.00392
Family Preprotein translocase SecE subunit 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A1HQJ6
Sequence length 78
Comment (tr|A1HQJ6|A1HQJ6_9FIRM) Protein translocase subunit SecE {ECO:0000256|HAMAP-Rule:MF_00422} KW=Complete proteome; Reference proteome OX=401526 OS=Thermosinus carboxydivorans Nor1. GN=TcarDRAFT_0984 OC=Thermosinus.
Sequence
MKWGCEKVAAQETAIPTNTARWKRFLRDVRAELKKVSWPNKQELVSYTGVVFVSVLVVAL
LIWVIDTGFSELLRLFIK
Download sequence
Identical sequences A1HQJ6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]