SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A1U3J4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A1U3J4
Domain Number - Region: 29-82
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 0.0235
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A1U3J4
Sequence length 87
Comment (tr|A1U3J4|A1U3J4_MARHV) Uncharacterized protein {ECO:0000313|EMBL:ABM19563.1} KW=Complete proteome OX=351348 OS=VT8). GN=Maqu_2488 OC=Alteromonadaceae; Marinobacter.
Sequence
MSLRDAIDNFYERLVLDAIDATREESDTADYLTDVMCVALNRLPGRYYRHTIDMMFYLAD
EELKEMKEKSLAAVRQARDFVRQHQRE
Download sequence
Identical sequences A0A2D9L8I1 A1U3J4
2005441709 351348.Maqu_2488 gi|120555399|ref|YP_959750.1| WP_011785947.1.7233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]