SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A1U3X2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A1U3X2
Domain Number 1 Region: 20-126
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.0000657
Family alpha-1,3-galactosyltransferase-like 0.064
Further Details:      
 
Weak hits

Sequence:  A1U3X2
Domain Number - Region: 126-154
Classification Level Classification E-value
Superfamily Proteinase A inhibitor IA3 0.0144
Family Proteinase A inhibitor IA3 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A1U3X2
Sequence length 283
Comment (tr|A1U3X2|A1U3X2_MARHV) Uncharacterized protein {ECO:0000313|EMBL:ABM19691.1} KW=Complete proteome OX=351348 OS=VT8). GN=Maqu_2616 OC=Alteromonadaceae; Marinobacter.
Sequence
MRLKIITLYSGEKEYGESKKSVKRQKVRHSVDVSFIENKTKPEAHGLLYEMIMSERHSYD
YFIKLDADMIFTDDGAVEKIIQYAVESGSDIFSIPVHDFLTDSMIWGLNVYRSGVRWFVD
SESLFTDQQRLNGCFSSSKRYLKKDESLVSHASMADDFQGFVFGIHRAAKIVQKSEKNVK
LGHSYIQLKTIKLVLSAWKKDKNRVRGWALVGAYLLAGNKLGRYDMTNRSDYIESFHSTD
FEKQIIEADKFFSKSTIFLMIEALGVVRFCKGIGFYLKRKIWL
Download sequence
Identical sequences A1U3X2
351348.Maqu_2616 gi|120555527|ref|YP_959878.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]