SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A1USJ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A1USJ1
Domain Number 1 Region: 10-78
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000000595
Family DNA-binding N-terminal domain of transcription activators 0.02
Further Details:      
 
Weak hits

Sequence:  A1USJ1
Domain Number - Region: 73-103
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00994
Family Pseudo ankyrin repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A1USJ1
Sequence length 168
Comment (tr|A1USJ1|A1USJ1_BARBK) Transcriptional regulator, MerR family {ECO:0000313|EMBL:ABM45371.1} KW=Complete proteome; Reference proteome OX=360095 OS=Bartonella bacilliformis (strain ATCC 35685 / KC583). GN=BARBAKC583_0640 OC=Bartonellaceae; Bartonella.
Sequence
MDKSPDAFRTISEVAELLGLPQHVLRFWETRFPQIKPLKRGGGRRYYRPVDIDFLNGIKQ
LLYGQGYTIKGVQRLLKENGTAFVIAIGSGDLDAMNVLIEKKHAEKFPESIQTQSKKKSA
FGLFEFMKGEEEEPVGAVNSHQNKTDKALLQEALFELIECKRVLDRIQ
Download sequence
Identical sequences A1USJ1
gi|121602593|ref|YP_988944.1| WP_005766853.1.100295 WP_005766853.1.16356 WP_005766853.1.26503 WP_005766853.1.46952 WP_005766853.1.47830 WP_005766853.1.52083 WP_005766853.1.55349 WP_005766853.1.64295 WP_005766853.1.80728 WP_005766853.1.81938 WP_005766853.1.90564 WP_005766853.1.94202 WP_005766853.1.95831 WP_005766853.1.963 WP_005766853.1.97869 360095.BARBAKC583_0640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]