SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2BVJ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A2BVJ1
Domain Number - Region: 127-134,215-245
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0418
Family Pseudo ankyrin repeat 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A2BVJ1
Sequence length 301
Comment (tr|A2BVJ1|A2BVJ1_PROM5) Uncharacterized protein {ECO:0000313|EMBL:ABM71802.1} KW=Complete proteome OX=167542 OS=Prochlorococcus marinus (strain MIT 9515). GN=P9515_05931 OC=Prochlorococcus.
Sequence
MTPNKKIDSIQNFKKSDWELDFYSRPIIEKNGKKRWELIISSSKTFKTEDIFLWNKICPA
NEVNSIWLTKSLNEALNDAERKGWEKPSKIRFWRASMKSIIKKSIENIGIEALVSRRTYE
LFDRIEFLEKEVYPLENGYVRGVLAPTFTSRIANDPTPLPEAVRGDALTISEISIEELKS
AENWPIEFGDIFPIKKSLKNENLVPGLRLFSKERSLALAAWFSSLEPVKLHIEKNQLILE
ASEDNKWLVTDLSEKVAKELNNKFTQNKNDSFGYQFISIQSTPFIEKFAGFWILRDIELI
S
Download sequence
Identical sequences A2BVJ1
gi|123965828|ref|YP_001010909.1| 167542.P9515_05931 WP_011819909.1.83733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]