SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2BW46 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A2BW46
Domain Number - Region: 39-123
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0235
Family Pseudo ankyrin repeat 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A2BW46
Sequence length 129
Comment (tr|A2BW46|A2BW46_PROM5) Uncharacterized protein {ECO:0000313|EMBL:ABM72007.1} KW=Complete proteome OX=167542 OS=Prochlorococcus marinus (strain MIT 9515). GN=P9515_07981 OC=Prochlorococcus.
Sequence
MKIVSNLIGLFFIFLMFFFNNSKLAFGSGNVDWILLKENNDGKEWLDMGSIKKFDNNEIS
VLTKFFKNPKDSSDKGQLSLYVMRINCDDNRFKDTSINGIPQLSSKWQTSNNDELIDVVI
EKSCSEIIN
Download sequence
Identical sequences A2BW46
WP_011820112.1.83733 167542.P9515_07981 gi|123966033|ref|YP_001011114.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]