SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2DBA0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2DBA0
Domain Number 1 Region: 489-798
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.51e-107
Family Ankyrin repeat 0.0000365
Further Details:      
 
Domain Number 2 Region: 256-587
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.28e-106
Family Ankyrin repeat 0.0000224
Further Details:      
 
Domain Number 3 Region: 124-266,293-325
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000000798
Family Pseudo ankyrin repeat 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A2DBA0
Sequence length 799
Comment (tr|A2DBA0|A2DBA0_TRIVA) Ankyrin repeat protein, putative {ECO:0000313|EMBL:EAY22430.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_379090 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MSDKDIHPNKFSELRSIGKYYIDSYNALYQLKTEKEEDLNSIYKLIKTELIDSHKHPPQI
IIRDILNIIPYNNRYTKSYLYLAKLLSDDYHVTEVNCVETISKFLFYKEYFEIDKSADFE
NMNSENLEIHTEDTIYIAIMYNDLERFITFTEIDGFDKDQTLENSLYPVYYQGYSLLELC
CYHGAVDCFKLLRTKFSSEITQKCLQFSFLGRNIEILSECLKYQTPDVECMEYAIISHNI
DFFTFLMNEYNIKIDLFYCAKHNNLESFLVYFDQTNDINKFYINSGMFNIPSLCEYFLSN
GANINEKDKYGRTSLHNSTYNNSKEIAELLISQGININEKDNFGQTALHYAAQKDSKEIA
ELLISQGININKKGNDGQTALHIAAENNSKGTAELLISQGININKKDKHGTTALHYVAEN
NSKGTAELHISQGININEKDNFGQTALHYAAQKDSKEIAELLISQGININKKGNDGQTAL
HIAAENNSKGTAELLISQGININKKDKHGTTALHYVAENNSKGTAELHISQGININEKDN
FGQTALHYAAQKDSKEIAELLISQGININKKGNDGQTALHIAAENNSKGTAELLISRGAN
INEKDNFGQTALHKAVIHNNKETVELHISQGININEKDNDGQTALHIAAENNSKETAELL
ISRGANINEKDNFGQTALHKAVIHNNKETVELHISQGININEKDNFGQTALHKTARYIDK
ETAELLISRGANINEKDNDGQTALHIAAENNSKGTAELLISRGANINEKDNFGQTALHKT
ARYIDKETAELLISHGAKI
Download sequence
Identical sequences A2DBA0
93440.m00524 5722.A2DBA0 XP_001583416.1.43485 gi|121917657|gb|EAY22430.1| gi|154420803|ref|XP_001583416.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]