SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2DDU9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2DDU9
Domain Number 1 Region: 136-359
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.54e-67
Family Ankyrin repeat 0.00017
Further Details:      
 
Domain Number 2 Region: 33-109
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000523
Family Pseudo ankyrin repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A2DDU9
Sequence length 365
Comment (tr|A2DDU9|A2DDU9_TRIVA) Ankyrin repeat protein, putative {ECO:0000313|EMBL:EAY21475.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_199140 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MDNSKERFIPLIESEEFDKDQKLVSDLYPRSFEGYSLLELCCYYGAVDCFKLLRTKFNSE
ITKKCLKLSFLSGNPDIISECLKYQKPNEKCIIYAIISHNIDFVTFLMNEYNLKNNLSSC
VCHNNLESFLVYFDQTNDINKCFVNSTVFNIPSLCEYFLSLGANIRERDEYGRTALHNAT
IYNCKEIIEILLSHGANINDKDNYGKTALFYTVDHNRKEIVELLLSHGANIDEQDYLRKT
TLFYAVENNCKEIIEFLLSHGANINARNQYGRTALIIATFNNNKEIVELLLSHGTSPNEK
GMNKETALHCAAYYNRREIAELLLLYGANIDEKDKDGNTPLFYATYNNSKETSDFLLLHT
SIINS
Download sequence
Identical sequences A2DDU9
5722.A2DDU9 86827.m00366 XP_001582461.1.43485 gi|121916696|gb|EAY21475.1| gi|154418887|ref|XP_001582461.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]